DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB6

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:371 Identity:112/371 - (30%)
Similarity:198/371 - (53%) Gaps:28/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKT----LVANNYRSLLSD 83
            :.|...|:| |:.:||:|....::||||.:.|.|..::..:|.|  ||:    .:...::|||::
Human    95 KTLGKDNSK-NVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSF--NKSGGGGDIHQGFQSLLTE 156

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-AIVNSWILNRTR 147
            :.:..|..:|.||||::..|....:..|....:|.::|:.:.:.....|..| ..:|:|:..:|.
Human   157 VNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTE 221

  Fly   148 GMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLS 212
            |.|..::.|...:..|...||||:||:|.|...|..:.|....|.||.||..||:||...::...
Human   222 GKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKK 286

  Fly   213 GYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVKLPK 270
            .||.:|..:|:.|||....|:|.|:||:....||.:::::   .|:::    .::::.|.|.||:
Human   287 TYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPR 351

  Fly   271 FKIESKAQLKGIFENLGILDVFK-PSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATG-- 332
            ||:|....::.:..|||:.|.|: ..||.:|: .::...:.|:|.|:|::::|:|.||:|||.  
Human   352 FKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAI 415

  Fly   333 VLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            ::.|..:.:.       .|.|||||.:.|..:|.  |.|.|....|
Human   416 MMMRCARFVP-------RFCADHPFLFFIQHSKTNGILFCGRFSSP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 111/366 (30%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 111/369 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.