DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:366 Identity:104/366 - (28%)
Similarity:182/366 - (49%) Gaps:23/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSEN---KTLVANNYRSLLSD 83
            ||.||.|:...|:.:||:|.....:|:.:.:...|.:|:...|.|:..   :..:...::.||..
Human    62 YRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRT 126

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRG 148
            |.:.::.:.|...|.:::::...||.:|.:..:|.:.::|.::...|...|...:|.::...|:|
Human   127 LNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQG 191

  Fly   149 MIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSG 213
            .|.::|  |:.:.||...|||.|:|||:|...|:...|...||:|.....:.|.||.........
Human   192 KIVDLV--KELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQ 254

  Fly   214 YIDDIDAKIIELPYWNSTLSMRIILPNSVDG-LRKLKEKV--GFIDYHLE---KKSVNVKLPKFK 272
            :...:.:.::.:.|..:..:: ..||:  :| |:.|:.::  ..|...||   ::|.::.|||..
Human   255 HCKKLSSWVLLMKYLGNATAI-FFLPD--EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLS 316

  Fly   273 IESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRR 337
            |.....||.:...|||..||...|||:|:..|:..|:.|.|.||.|.|||||.||:.|..:    
Human   317 ITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFL---- 377

  Fly   338 KKSIDNLIQPPMEFIADHPF-FYVIHDN-KVIYFQGHIVEP 376
             ::|...|.|.::|  :.|| |.:|..| |...|.|.:|.|
Human   378 -EAIPMSIPPEVKF--NKPFVFLMIEQNTKSPLFMGKVVNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 102/361 (28%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 102/361 (28%)
RCL 368..392 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.