DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINF1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:392 Identity:95/392 - (24%)
Similarity:175/392 - (44%) Gaps:52/392 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLV 73
            ||.:| |.|..|.||:.:|.:...|::.||:|....:|.:.:.:..:|...:...|.:.    |:
Human    54 LAAAV-SNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYD----LI 113

  Fly    74 AN-----NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSI----RLD 129
            ::     .|:.||..:...:.  .|..|:||...||..:...|.....|::..:.:.:    |||
Human   114 SSPDIHGTYKELLDTVTAPQK--NLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLD 176

  Fly   130 DPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVS 194
                 ...:|:|:..:.:|.:....  |:...:.|..|:...:|||||:..|.:.:|.:.|||:.
Human   177 -----LQEINNWVQAQMKGKLARST--KEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLD 234

  Fly   195 ANEIIPVKMMT-LSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSV-DGLRKLKEKV--GFI 255
            ....:.|.||: ..|.|..|...|:..||.:||...| :|:...||..| ..|..::|.:  .||
Human   235 EERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGS-MSIIFFLPLKVTQNLTLIEESLTSEFI 298

  Fly   256 -DYHLEKKSVNVKL--PKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAF 317
             |...|.|:|...|  ||.|:..:.::....:.:.:..:| .|.|.: .:.....|:.::..:|.
Human   299 HDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLF-DSPDFS-KITGKPIKLTQVEHRAG 361

  Fly   318 LKIDEKGGEASAATGVLTRRKKSIDNLIQP-----PMEFIADHPFFYVIHDNK--VIYFQGHIVE 375
            .:.:|.|...:.:.|            :||     |:::..:.||.:|:.|..  .:.|.|.|::
Human   362 FEWNEDGAGTTPSPG------------LQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILD 414

  Fly   376 PR 377
            ||
Human   415 PR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 88/378 (23%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 93/389 (24%)
O-glycosylated at one site 371..383 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.