DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA5

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:388 Identity:104/388 - (26%)
Similarity:186/388 - (47%) Gaps:41/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEEL-----RNVLKFSE 68
            :|.|....|..|.||.|||....:::.:||:|..:.::|:.:.:|..|..::     .|:.|.||
Human    40 VAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSE 104

  Fly    69 NKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVS 133
            .:  :...::.||.:|.:......|.:.|.::.:....|...|....:..:.|........|...
Human   105 KE--LHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAG 167

  Fly   134 ASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEI 198
            |...:|.::..:|:|.|  :.|.|:.:|:....:||.|:||.:|..:|....|...||||::..:
Human   168 AMKQINDYVAKQTKGKI--VDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETV 230

  Fly   199 IPVKMMTLSASLLSGYIDD--IDAKIIELPYWNSTLSMRIILPN-----------SVDGLRK-LK 249
            :.|.||:.....  .|:.|  :..:::.:||..:..:: .|||:           |...||| ||
Human   231 VRVPMMSREDQY--HYLLDRNLSCRVVGVPYQGNATAL-FILPSEGKMQQVENGLSEKTLRKWLK 292

  Fly   250 EKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQ 314
                    ..:|:.:.:.||||.||...||:.:..:|||.:||...|||:|:...|..::.::|.
Human   293 --------MFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVH 349

  Fly   315 KAFLKIDEKGGEASAATG-VLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVEP 376
            ||.:::||.|..|:|||| :.|.|...:::     ...:.:.||...|.||.:: |.|.:..|
Human   350 KAVVEVDESGTRAAAATGTIFTFRSARLNS-----QRLVFNRPFLMFIVDNNIL-FLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 101/375 (27%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 101/379 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.