DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001137290.1 Gene:SERPINB2 / 5055 HGNCID:8584 Length:415 Species:Homo sapiens


Alignment Length:410 Identity:114/410 - (27%)
Similarity:204/410 - (49%) Gaps:61/410 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS------------ENKT- 71
            :.::.||..:..:||..||.|....|:||||.|.|.|.:::..||:|:            ||.| 
Human    14 NLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTS 78

  Fly    72 -----------------------LVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQ 113
                                   .:.:::|||.|.:.......:|...|:::..|......|:.:
Human    79 CGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIR 143

  Fly   114 LARKAFKAKAKSIR-LDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQW 177
            |.:|.:.::.:::. |:....|...:|||:..:|:|.|.|::.....:.||...||||:||||:|
Human   144 LCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKW 208

  Fly   178 LYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSV 242
            ...|:.....:..|.|::.:..||:||.|...|..|||:|:.|:|:|||| ...:||.::||:.:
Human   209 KTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPY-AGDVSMFLLLPDEI 272

  Fly   243 ----DGLRKLKEKVGFIDYH-------LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPS 295
                .||..|:.::.:...:       :.:..|.|.:|:||:|...:|:.|..::|:.|.| |..
Human   273 ADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGR 337

  Fly   296 ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAAT-GVLTRRKKSIDNLIQPPMEFIADHPF-F 358
            |:.:|:...:...:.::..:|.:.::|:|.||:|.| ||:|.|..      ....:|:||||| |
Human   338 ANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTG------HGGPQFVADHPFLF 396

  Fly   359 YVIH--DNKVIYFQGHIVEP 376
            .::|  .|.:::| |....|
Human   397 LIMHKITNCILFF-GRFSSP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 113/405 (28%)
SERPINB2NP_001137290.1 PAI-2 4..415 CDD:239013 113/408 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.