DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINE1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:378 Identity:98/378 - (25%)
Similarity:177/378 - (46%) Gaps:37/378 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS-E 68
            |:..||    |.|....::.:|..:..||:::||.....:::|:.:.:||:|.::::..:.|. :
Human    30 YVAHLA----SDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKID 90

  Fly    69 NKTL---VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD 130
            :|.:   :.:.|:.|:....:.|    :...:.|:|.:...||..|.....:.|::..|.:...:
Human    91 DKGMAPALRHLYKELMGPWNKDE----ISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSE 151

  Fly   131 PVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSA 195
            ...|..|:|.|:...|:|||.|::.....:..|...||||:||.|||...|....||...|:.|.
Human   152 VERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSD 216

  Fly   196 NEIIPVKMMT-------LSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNS----VDGLRKL- 248
            ...:.|.||.       ...:...|:..|    |:||||...||||.|..|..    :..|..: 
Human   217 GSTVSVPMMAQTNKFNYTEFTTPDGHYYD----ILELPYHGDTLSMFIAAPYEKEVPLSALTNIL 277

  Fly   249 -KEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGAKIDK 311
             .:.:.....::.:....:.||||.:|::..|:...||||:.|:|:. .||...|..:....:.:
Human   278 SAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQ 342

  Fly   312 IVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN 364
            .:||..::::|.|..||::|.|:...:.:       |.|.|.|.||.:|:..|
Human   343 ALQKVKIEVNESGTVASSSTAVIVSARMA-------PEEIIMDRPFLFVVRHN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 94/366 (26%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 98/378 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.