DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn42Da

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:364 Identity:126/364 - (34%)
Similarity:204/364 - (56%) Gaps:18/364 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF-SENKTLVANNYRSLLSDLK 85
            |..|:.|....|:::||.|.:...:|..:.:..:|..:|...|.. |.:...:|:::..:|:..:
  Fly    53 YGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQ 117

  Fly    86 RRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMI 150
            ..:   ||.:||:|:|...|.|..||:||..|.|.:.|:|:.....|.|:|.:|:|:..||..:|
  Fly   118 DSQ---ILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLI 179

  Fly   151 RNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYI 215
            :::|.....||::...|||||:|||.|.:.|....|....|::.....:.|.||:|........:
  Fly   180 KDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADL 244

  Fly   216 DDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF-----IDYHLEKKSVNVKLPKFKIES 275
            ..:||..:||||.:|.|||.|:|||:..||..|:||:..     |...|.:..|.:|||:||.|.
  Fly   245 PALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEF 309

  Fly   276 KAQLKGIFENLGILDVFKPSADLNGLVLES--GAKIDKIVQKAFLKIDEKGGEASAATGVLTRRK 338
            :.:|..:|:.||:..:|...|:. |.:|:|  ..|:..|:.|||::::|:|.||:||||:..|||
  Fly   310 QVELSEVFQKLGMSRMFSDQAEF-GKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRK 373

  Fly   339 KSIDNLIQP--PMEFIADHPFFYV-IHDNKVIYFQGHIV 374
            ::|   :.|  |:||.|||||.|| :|...:..|.|.:|
  Fly   374 RAI---MSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 125/361 (35%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 125/361 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446376
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
109.900

Return to query results.
Submit another query.