DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn88Ea

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:405 Identity:113/405 - (27%)
Similarity:185/405 - (45%) Gaps:62/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNV--LKFSENKTLVANN 76
            :..|......::.......|:.:||.|....:.:.|..|.|.|.:||..|  |.::::|.:|.:.
  Fly    40 QQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSA 104

  Fly    77 YRSLLSDLKRRETF----IILHMANRI-YVNKKYCLVPEFNQLARKA----FKAKAKSIRLDDPV 132
            |  :|..:.|:|..    :....|:|| :.|..:......|:||.:.    ||::.:..|..   
  Fly   105 Y--ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQ--- 164

  Fly   133 SASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANE 197
                 :|.||..:|...|||::...:....|...|.||.|.|||||..||.::|....||.|.:.
  Fly   165 -----INDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224

  Fly   198 IIPVKMMTLSASLLSGYIDDIDAKIIELPY---------------WNSTLSMRIILP----NSV- 242
            ...|.||....:.|....:.:.|.:::|||               .||.:||.:|||    ||: 
  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289

  Fly   243 DGLRKLKEKVGFIDYHLEK---KSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSA----DLNG 300
            |.|.:|  ....:|..|::   :.:.|.||||:.|.:.:|..|...:|:..:|..|.    ||..
  Fly   290 DVLSRL--NADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTS 352

  Fly   301 LVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLT-RRKKSIDNLIQPPMEFIADHPFFYVIHD- 363
            ..:..|.  .|.|.|  :|:||:|..|:|||.:.| |..:.::     |.:|..:|||.:||:| 
  Fly   353 ETISIGD--SKHVAK--IKVDEEGSTAAAATVLFTYRSARPVE-----PAKFECNHPFLFVIYDR 408

  Fly   364 -NKVIYFQGHIVEPR 377
             ::.|.|.|...:|:
  Fly   409 TSRSILFTGIYRDPK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 112/396 (28%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 112/399 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.