DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpina3

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001011275.1 Gene:serpina3 / 496728 XenbaseID:XB-GENE-5933441 Length:414 Species:Xenopus tropicalis


Alignment Length:393 Identity:106/393 - (26%)
Similarity:187/393 - (47%) Gaps:51/393 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVESGFWEDFYRILAS------QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK 70
            |....|..:.|:.|.:      ::.::|:::||:|.....||:.:.:..::.:::.:.|  |.|:
 Frog    42 SANIDFALNLYKHLVTKTQAEKESTQKNIVFSPLSILTAFSMLLLGAKSESHQQILSGL--SLNQ 104

  Fly    71 TLVANN-----YRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD 130
            |.|...     :..||..|.|.::.:.:.:.|.::|.....::..|.|.....:.|:.......:
 Frog   105 TQVPEEDMHEAFEHLLQVLNRPKSDLQVKIGNAVFVEDTLKILDSFVQEIEHHYHAEIFPSHFKN 169

  Fly   131 PVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSA 195
            |..|...:|.::.|:|.|.|:.:|  ||.:..|...::|.|.|..:|...|.:..||...|.|..
 Frog   170 PAEAEKQINDFVNNKTEGRIQELV--KDLSEATKLVVINFILFNAEWQNPFSSFFTHSRQFSVDE 232

  Fly   196 NEIIPVKMMTLSASLLSGYIDD-IDAKIIELPYWNSTLSMRIILPN-----------SVDGLRKL 248
            |..:.|:||: ...|...|.|: |...:::|||.|:. ||.||:|.           ||:.|::.
 Frog   233 NTTVEVQMMS-KTDLYQFYKDEKIPCSVLQLPYKNNA-SMLIIVPELGKIHEVEEALSVETLKRW 295

  Fly   249 KEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIV 313
            ....       ||....:.||||.|.|..:||.|..::|:..:|..:||.:|:...|..|:.|:|
 Frog   296 TSSA-------EKSFFELFLPKFSISSSLKLKDILTDMGMGIIFTDAADFSGISENSRLKLSKVV 353

  Fly   314 QKAFLKIDEKGGEASAAT---GVLTRRKKSIDNLIQPPMEFIADHPFFYVI--HDNKVIYFQGHI 373
            .||.|.:.|.|.||:||:   ||||       :|:   ::|:.|.||..:|  .:...|.|...:
 Frog   354 HKAVLNVAENGTEAAAASAVEGVLT-------SLM---VQFVVDKPFITLICSQEPYSILFMSRV 408

  Fly   374 VEP 376
            ::|
 Frog   409 IDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/383 (27%)
serpina3NP_001011275.1 serpinA 43..411 CDD:381073 104/390 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.