DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:385 Identity:116/385 - (30%)
Similarity:208/385 - (54%) Gaps:24/385 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK----T 71
            ::..:.|..:.::.::..||..|:.|||:|....::||.:.:.|.|.:::..||.|:...    .
Zfish     5 SAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVE 69

  Fly    72 LVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIR-LDDPVSAS 135
            .:.:|::..:|:|.:.|...:|.:|||:|..:.|.|:.:|....::.:.|..:.:. ::....|.
Zfish    70 QIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDAR 134

  Fly   136 AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIP 200
            ..:|:|:...|:..|::::.....::.|...|||||||||.|...|..:.|....|.::.|:..|
Zfish   135 VNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKP 199

  Fly   201 VKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVD----GLRKLKEKVGF---IDYH 258
            ||||...|...||||:::.:.::||||....|||.||||:.::    ||:||:..:.:   :::.
Zfish   200 VKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWT 264

  Fly   259 ----LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGAKIDKIVQKAFL 318
                :.::.|.|.|||||.|....:|.:..::|:.|||.| ..:|.|:...:...:.|.:.|||:
Zfish   265 KPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFV 329

  Fly   319 KIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            :::|:|.||:|||..:.:....|     ||:.|.|||||.:.|..|  |.|.|.|.:..|
Zfish   330 EVNEEGTEAAAATAAIEKLMCYI-----PPLSFNADHPFLFFIRHNPTKSILFYGRLCSP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 115/374 (31%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 115/383 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3432
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.