DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn43Aa

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster


Alignment Length:373 Identity:121/373 - (32%)
Similarity:198/373 - (53%) Gaps:27/373 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS--ENKTLVANNYRS 79
            |..:.::.||:.....|:|.||:|.::.:.:.|..:.|:|..||:..|..|  |:|..:|.:|.:
  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHN 94

  Fly    80 LLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILN 144
            ||....:.:|  :|.:||::|..:...:...|.::|:|.|.::.:.:.......|...:|.|:..
  Fly    95 LLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQ 157

  Fly   145 RTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSAS 209
            :|...|..:|  :....||:..||||||||.:|...|..:.|...:|::|.:..|.|.  |:.|.
  Fly   158 QTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVP--TMFAD 218

  Fly   210 LLSGYID--DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHL-----EKKSVNVK 267
            ....|.|  ::|||.|||.:.|..|:|..||||...||:.|::|:..:|::|     :.:||:|.
  Fly   219 NWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVY 283

  Fly   268 LPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLES--GAKIDKIVQKAFLKIDEKGGE---A 327
            |||||.|....|:.....:||..:|..:||.:.:..:|  |.:|.|:..|.|:.::|.|.|   |
  Fly   284 LPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGA 348

  Fly   328 SAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVE 375
            |.|.||..       :|...|..|:|||||.::|.|...:||.||||:
  Fly   349 SYAAGVPM-------SLPLDPKTFVADHPFAFIIRDKHAVYFTGHIVK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 118/369 (32%)
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 118/369 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446371
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
109.900

Return to query results.
Submit another query.