DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn43Ab

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster


Alignment Length:397 Identity:105/397 - (26%)
Similarity:178/397 - (44%) Gaps:47/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVES---GF---------WEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFE 58
            ||||||..:|   |:         ..|.|..:|:.:...|::.||.:.:..|::.::.:.|:|..
  Fly     9 LLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTAS 73

  Fly    59 ELRNVLKFSE-NKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAK 122
            ||:..|:... :...|:....|....|.|...|   .:||.||:|:.......|..:|::.|.:.
  Fly    74 ELQQGLRLGPGDADAVSQRSGSYQQALTRDNNF---RLANNIYINENLEFKGSFRDVAQRQFDSN 135

  Fly   123 AKSIRLDDPVSASAI--VNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQ 185
            ...:....|.:....  :|..:..:|.|.|.:|:..:..|..|...:||.:.:...|...|:.|:
  Fly   136 IDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDK 200

  Fly   186 THIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKE 250
            |....|...:.:.:.|..|....:.....::.:|||::||||.|...||.::|||..||||.|::
  Fly   201 TEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQ 265

  Fly   251 ---------KVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLV-LES 305
                     ::|    .:.::.|.|.||||.:.....|:|.|:.||:..:|....|...:. :..
  Fly   266 SLSGKNLLAEIG----AMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFV 326

  Fly   306 GAKIDKIVQKAFLKIDEKGGEASAATGVL----TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV 366
            ...|:.:..||.:::.|.|.:....||:|    :|.||           |.|||||.:.|.....
  Fly   327 SHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKK-----------FEADHPFVFAIKYKDS 380

  Fly   367 IYFQGHI 373
            |.|.|||
  Fly   381 IAFIGHI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 95/381 (25%)
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 95/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.