DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn100A

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:128/278 - (46%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 AKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTH 187
            |:|:...|.::::...|| |..|:.|            |.:...|.|.:|::|.|...|...:..
  Fly   371 ARSLFQQDDITSALSANS-ITGRSAG------------SKSKMLLFNGLYYRGSWANPFYQLRDG 422

  Fly   188 IADFYVSANE-IIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEK 251
            ..:|:...|| .:...||..........:..:.|:::.|||..|..::.|:||:..:||..:..:
  Fly   423 SDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQ 487

  Fly   252 VGFIDYHLEK-----KSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKID 310
            :...|:.|.|     |.:::.:|||::|..::.:.:.:.:|:..|| :..|.|:.|..:....:|
  Fly   488 LQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKVFSRTEAQLSLLSEDPDVHVD 552

  Fly   311 KIVQKAFLKIDEKGGEA---SAATGVLTRRKKSIDNLIQPPME----------FIADHPFFYVIH 362
            :|||...:::||.|..|   ||||  :..|..|:::.:.|..|          |..:.||.|.|.
  Fly   553 EIVQFVNVRVDEGGSSANSLSAAT--MQARTPSVESTVLPVPEPEPELPGVERFEVNRPFAYFIV 615

  Fly   363 D--NKVIYFQGHIVEPRW 378
            |  .:.:...|.|..|.:
  Fly   616 DCQEQFVLASGKIYTPEF 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 67/271 (25%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 64/262 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.