DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:374 Identity:108/374 - (28%)
Similarity:198/374 - (52%) Gaps:31/374 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVL---KFSENKTLVANNYRSLLSD 83
            :|:|...::| |:.:|..|....::::.|.:.|.|..::..||   |.|.....|...::|||::
Mouse    68 FRVLGEDSSK-NVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGADVQQGFQSLLTE 131

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLD---DPVSASAIVNSWILNR 145
            :.:.:|..:|..||:|:.:..:.::..|.:...|.::.:.:  :||   .|......:|:|:..:
Mouse   132 VNKTDTGHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIE--KLDFKGTPEQCRQHINAWVAKK 194

  Fly   146 TRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASL 210
            |:.:||.::.....||:|...||||.||||:|...|..:.|....|.||.||...|:||:..::.
Mouse   195 TKDVIRELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVSKNEKKTVQMMSKKSTF 259

  Fly   211 LSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF---IDY----HLEKKSVNVKL 268
            .:.|.::|...|:.|||.:..|||.|:||:....|..::.::.:   |.:    .:|::.|.|.|
Mouse   260 KTYYAEEISTTIVFLPYTDKELSMIIMLPDEQVELSMVENQISYKKLIQWTRLVKMEEEEVQVFL 324

  Fly   269 PKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATG 332
            |:||:|:...:|.:...||:.|.|:.| ||.:|:..:.|..:..:|.|:|::::|:|.||:.||.
Mouse   325 PRFKLEATYDMKDVLCKLGMTDAFEESRADFSGISSKKGLFLSNVVHKSFVEVNEEGTEAAVATE 389

  Fly   333 VLTRRKKSIDNLIQPPME---FIADHPFFYVIH--DNKVIYFQGHIVEP 376
            ::|         :..|:.   .|||.||.::|.  .:|.|.|.|....|
Mouse   390 IVT---------VGSPLTQRCLIADRPFLFLIQGDKSKEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 107/369 (29%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 107/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.