DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn85F

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:238 Identity:56/238 - (23%)
Similarity:96/238 - (40%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LPKDFNSDTSAFLVNAIYFKGQWLYNFKADQ-THIADFYVSANEIIPVKMMTLSASLLSGYIDDI 218
            :|..|...|:.|..:.|....:...|:..|. :|:  ||:...:::.......:|.|...|.:.:
  Fly   415 VPAAFAPITNDFEPHYIGEAAEGKSNYNTDVISHV--FYLGNQQVVHTTFKVYNAVLYYKYFEHL 477

  Fly   219 DAKIIELPYWNSTLSMRIILPN------SVDGLRKLKEKVGFIDYHLEKKSVNVKLPKFKIESKA 277
            ...::||.......::.|:||:      :.....||...:..:...|:.:.|...:|.||:....
  Fly   478 KMSVLELELDTPEYNLMILLPDYHTDIVAAAASLKLGPTLRLMRKQLKPRWVQAIIPDFKLHGTM 542

  Fly   278 QLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSI 341
            .|....:|:||.|||:|: ||...:..|.|..:..|.|    .||            :|.|...|
  Fly   543 FLTNDLQNMGICDVFEPNRADFRPMTEEKGVYVRHIEQ----SID------------VTIRTHPI 591

  Fly   342 DNLIQ------PPMEFIADHP--FFYVIHDNKVIYFQGHIVEP 376
            :.|.:      .|::...:||  ||.|..|..|....|.|:.|
  Fly   592 NQLKRNYGAQSKPIQISVNHPFLFFIVDRDLDVAVMSGRILNP 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 54/233 (23%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 47/199 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.