DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn77Ba

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:371 Identity:97/371 - (26%)
Similarity:172/371 - (46%) Gaps:35/371 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKRRETFII 92
            :.|.::.:.||.|...::.::|..|.|:|..:|:..|:.:.....:...|:...|.|....:.|.
  Fly    92 EKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKVWSSFLNITTSTIE 156

  Fly    93 LHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPK 157
            :.....||..|.|.:...:.. |.:.:..:...:....|.|...| |......|||:|...:||:
  Fly   157 VATLQAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSPDSVIQI-NEDTNRTTRGLIPYTILPQ 219

  Fly   158 DFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII-PVKMMTLSASLLSGYIDDI--- 218
            |... ...||::::||||||.:.|....|....|:..:.|:| .:.||...|:.  .|:.::   
  Fly   220 DVYG-AKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANF--AYVSNVEGL 281

  Fly   219 DAKIIELPY-WNSTLSMRIILP------NSVD------GLRKLKEKV-GFIDYHLEKKSVNVKLP 269
            |..::|||| ....|:|.::||      |.|.      |||.:.::: .|.:...|...|.|.:|
  Fly   282 DGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASEDNEVEVMMP 346

  Fly   270 KFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGV 333
            ||...:...|||:...:||.|:| :.:|:|:.  :.||.....:|....:.:||:|..|.|.|  
  Fly   347 KFVTATDFTLKGVLIQMGIRDLFDENTANLDR--MSSGLFAKLVVHSTKIIVDEQGTTAGAVT-- 407

  Fly   334 LTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEPR 377
                :.::.|...|| :|:.:.||.|:|.:..  ::.|.|.:..|:
  Fly   408 ----EAALANKATPP-KFLLNRPFQYMIVEKATGLLLFAGQVRNPK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/365 (26%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 96/365 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.