DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpine2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_988931.2 Gene:serpine2 / 394528 XenbaseID:XB-GENE-947567 Length:395 Species:Xenopus tropicalis


Alignment Length:375 Identity:100/375 - (26%)
Similarity:177/375 - (47%) Gaps:36/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLK 85
            |.:::.|: ...|.:.||.....::.|:.:.:.|||.::|..|:::..|:  ||.:.:.:...:.
 Frog    38 FNQVVKSR-PHENFVMSPHGISSVLGMLQLGADGKTKKQLMTVMRYKINE--VAKSLKKINRAIV 99

  Fly    86 RRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMI 150
            .::...|:..||.::.:..:.:...|....:..|.:..:|:...:..:|::|:|.|:.|:|.|||
 Frog   100 AKKNKDIVTSANGVFASSVFKMESSFVYKNKDVFHSDVRSVDFQEKNTAASIINQWVKNQTNGMI 164

  Fly   151 RNIVLPKDFNSD-TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGY 214
            ..::.|:..:|. |...||||:||||.|...|:.:.|....|:....:...|.|:...:...||.
 Frog   165 EGLISPELLDSSVTRLVLVNALYFKGLWKSRFQPENTKKRTFHGPDGKDYQVPMLAQLSLFRSGS 229

  Fly   215 IDDIDA---KIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKS-----------VN 265
            ....:.   .:|||||...:|||.:.||.      :....:..|..|:..|:           |.
 Frog   230 ASTPNGLWYNVIELPYHGGSLSMLVALPT------EESTPLSAIIPHISTKTLQSWMTMTPKRVQ 288

  Fly   266 VKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEAS- 328
            :.||||.:|::|.||....||||.::|..| |:...:.......:..::|||.::::|.|.:|| 
 Frog   289 LILPKFSVEAEADLKEPLRNLGITEMFDVSKANFAKITRSESLHVSHLLQKAKIEVNEDGTKASG 353

  Fly   329 AATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            |.|.||..|..        |..|..|.||.:.|..|.  .:.|.|.|.:|
 Frog   354 ATTAVLIARSS--------PRWFTVDRPFLFFIRHNPTGAVLFTGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/370 (26%)
serpine2NP_988931.2 serpinE2_GDN 30..393 CDD:381039 98/371 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.