DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb3d

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:395 Identity:116/395 - (29%)
Similarity:203/395 - (51%) Gaps:34/395 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE-- 68
            |..:||   :.|..:.||.|  :.:..|:.|||||....::|:.:.:...|.::::.||.|:|  
Mouse     3 LFAVAT---TKFTLELYRQL--RESDNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETT 62

  Fly    69 NKTL-----------VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAK 122
            .||.           |...::.|::.|.:......|.:.|.||..|.:..:..|.:..||.::|.
Mouse    63 KKTTEKSAESHDEENVHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQAN 127

  Fly   123 AKSIRLDDPVSAS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQT 186
            .:|:........| ..:|||:..:|.|.|:::......||.|...||||:||||||.:.|....|
Mouse   128 VESLDFAHAAEESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHT 192

  Fly   187 HIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEK 251
            ....|:::.|...||:||.........:::::.|||:|:||....|||.::||..:|||:|.:|:
Mouse   193 REEKFWLNKNTSKPVQMMKQRNKFNFIFLENVQAKIVEIPYKGKELSMFVLLPVEIDGLKKFEEQ 257

  Fly   252 V---GFIDY----HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGAK 308
            :   ..:.:    ::....:.:.||:||:|.|..|:...|::|::|.|.| .||.:|:....|..
Mouse   258 LTADKLLQWTRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQGLV 322

  Fly   309 IDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQG 371
            :.|::.|:|::::|:|.||:.|..|.:|...     :..|.:|..:|||.:|:..||.  |.|.|
Mouse   323 VSKVLHKSFVEVNEEGAEAATAMSVESRSLS-----VPKPNDFSCNHPFLFVMKQNKTNSILFFG 382

  Fly   372 HIVEP 376
            .:..|
Mouse   383 RVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 112/379 (30%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 114/389 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.