DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpine2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:382 Identity:106/382 - (27%)
Similarity:176/382 - (46%) Gaps:50/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSEN---KTLVANNYRSLLS 82
            |.::| ...|:.|::.||.....::.|:...:.|.|..:|.|.||:.:|   |.|     |.|..
Zfish    38 FMQVL-QDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQLLNGLKYKKNGPYKML-----RKLHK 96

  Fly    83 DLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTR 147
            .|..:....|:.:||.::.|:.:.:..:|....|:.|..::.|:...||.:|:..:|.|:.|.|:
Zfish    97 SLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCESHSVDYSDPEAAAQSINDWVKNSTK 161

  Fly   148 GMIRNIVLPKDFNSD-TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLL 211
            |.|.::|....|::. |....||:|:|||.|...|:...|....|.........|.||:..:...
Zfish   162 GQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYKVPMMSQLSVFN 226

  Fly   212 SGYIDDIDAK---IIELPYWNSTLSMRIILP----------------NSVDGLRKLKEKVGFIDY 257
            .|.....|.:   :|||||..:::||.|.||                |::....||         
Zfish   227 MGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDSTPLSSILPHISTNTIQSWTKL--------- 282

  Fly   258 HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKID 321
             :..:.:.:.:|||.:|.:..|:...:.|||.|:| :..||...|..|| ..:.|.:|||.::::
Zfish   283 -MNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSES-IYVSKALQKAKIEVN 345

  Fly   322 EKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            |.|.:|||.|.|:...:.|      ||...: |.||.::|..|.  .|.|.|.|.:|
Zfish   346 EDGTKASATTSVILHARSS------PPWVTV-DRPFLFLIRHNSSGTILFAGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/377 (28%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 105/380 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.