DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:409 Identity:110/409 - (26%)
Similarity:179/409 - (43%) Gaps:77/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ESGFWE----------------DFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRN 62
            :.|.||                |.|:.||..:...|::.:|.|..:..:|:.:.:...|..|:..
Human    41 DQGDWEDLACQKISYNVTDLAFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILE 105

  Fly    63 VLKFSENKT---LVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAK 124
            .|..:..:|   .:...::.:|..|.|.:|.:.|...:.::|||...||..|.:..:|.:.::|.
Human   106 GLNVNLTETPEAKIHECFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEAS 170

  Fly   125 SIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIA 189
            ||...|...|...:|:::..||...:.::|  |....|||..||:.|.|.|:|...|||:...:.
Human   171 SINFRDTEEAKEQINNYVEKRTGRKVVDLV--KHLKKDTSLALVDYISFHGKWKDKFKAEHIMVE 233

  Fly   190 DFYVSANEIIPVKMMTLSASLLSGYIDDIDA-KIIELPYW--------NSTLSMRIILPNSVDGL 245
            .|:|....||.|.|:        .::...|. :..||..|        |:|..  .|||:. ..:
Human   234 GFHVDDKTIIRVPMI--------NHLGRFDIHRDRELSSWVLAQHYVGNATAF--FILPDP-KKM 287

  Fly   246 RKLKEKVGFIDYHLEK-------KSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVL 303
            .:|:||:.:  .|||.       :|:|:..||..|....:||.:..||||..:|...|||:|:..
Human   288 WQLEEKLTY--SHLENIQRAFDIRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQ 350

  Fly   304 ESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPME---------FIADHPFFY 359
            |:..|:.|.|..|.|.|||||.||:.|                |.:|         .:.:.||..
Human   351 EAPLKLSKAVHVAVLTIDEKGTEATGA----------------PHLEEKAWSKYQTVMFNRPFLV 399

  Fly   360 VIHDNKVIY--FQGHIVEP 376
            :|.|:...:  |.|.:|.|
Human   400 IIKDDITNFPLFIGKVVNP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 107/401 (27%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 106/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.