DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:387 Identity:119/387 - (30%)
Similarity:206/387 - (53%) Gaps:37/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE--NKTL------- 72
            |..:.||.|  :.:.:|:.|||||....::|:.:.:.|.|..::..||:|.|  .||.       
Mouse    11 FAVEMYRQL--RESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHCD 73

  Fly    73 ----VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVS 133
                |...::.|::.|.:......|..||.||..|.:..:..|.:..::.::||.:|:..:....
Mouse    74 DEENVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHATE 138

  Fly   134 AS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANE 197
            .| ..:|||:.::|.|.|:::......:|.|...||||:||||||...|..:.|....|:::.|.
Mouse   139 ESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNKNT 203

  Fly   198 IIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEK---------VG 253
            ..||:||.........::.|:.|:|:|:||....|||.::||..:|||::|:|:         :.
Mouse   204 SKPVQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIK 268

  Fly   254 FIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGAKIDKIVQKAF 317
            ..:.||.:  :.:.||:||:|.|..|:...|::|::|.|.| .||.:|:....|..:.|::.|:|
Mouse   269 AENMHLTE--LYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKSF 331

  Fly   318 LKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPF-FYVIH--DNKVIYFQGHIVEP 376
            ::::|:|.||:|||||....:.:     |...:|..|||| |::||  .|.:::| |.|..|
Mouse   332 VEVNEEGTEAAAATGVEVSVRSA-----QIAEDFCCDHPFLFFIIHRMTNSILFF-GRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 117/382 (31%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 118/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.