DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb3c

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:399 Identity:116/399 - (29%)
Similarity:205/399 - (51%) Gaps:42/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE--N 69
            ::|....:..|..:.||.|  :.:.:|:.|||||....:.|:.:.:.|.|..::..||:.:|  .
Mouse     1 MILFPEADGKFTVEMYRQL--RESDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTE 63

  Fly    70 KTL-----------VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKA 123
            ||.           |...::.|::.|.:......|..||.||..|.:.|:..|.:..::.:.|..
Mouse    64 KTTEKSAHCDDEDNVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYHANV 128

  Fly   124 KSIRLDDPVSAS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTH 187
            :|:..:.....| ..:|.|:.|.|.|.|:::......:|.|...||||:||||:|.:.|..:.|.
Mouse   129 ESLDFEHAAEESEKKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDENNTI 193

  Fly   188 IADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV 252
            ...|:::.|..|||.||......:..:::|:.|:|:|:||....|||.::||..:|||::|::::
Mouse   194 EEMFWLNKNTSIPVPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQL 258

  Fly   253 GFI---------DYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGA 307
            ...         :.||.:  :.:.||:||:|.|..|....|.:|:::.|.| .||.:|:....|.
Mouse   259 TAAKLLEWTRAENMHLTE--LYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGMSSTQGL 321

  Fly   308 KIDKIVQKAFLKIDEKGGEASAATG--VLTRRKKSIDNLIQPPMEFIADHPF-FYVIHD--NKVI 367
            .:.|::.|:|::::|:|.||..|:|  |:.|..:..|        |..|||| |::||.  |.::
Mouse   322 VVSKVLHKSFVEVNEEGTEADPASGEEVILRLAQVAD--------FRCDHPFLFFIIHSKTNSIL 378

  Fly   368 YFQGHIVEP 376
            :| |.|..|
Mouse   379 FF-GRISSP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 113/384 (29%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 114/392 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.