DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb1c

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:385 Identity:125/385 - (32%)
Similarity:193/385 - (50%) Gaps:33/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVAN 75
            :|..:.|..:.:..|...|...|.|:||:|....::|||:.:.|.|..:|...|.|...:. :.:
Mouse    38 SSANNLFALELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFDSAED-IHS 101

  Fly    76 NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS----A 136
            .::||.:::.:|.....|.:|||:|..|.|..:||:....:|.:.|   .:.|.|...||    .
Mouse   102 QFQSLTAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSA---DLALVDFQHASEDARK 163

  Fly   137 IVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPV 201
            .:|.|:..:|...|:.:......:|.|...||||.||||.|...|.|..|..|.|.:|......|
Mouse   164 EINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTV 228

  Fly   202 KMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVD----GLRKLK-----EKVGFIDY 257
            |||.|..:|..|||.|:..|::|:||....|||.|:||..::    ||.:::     ||:...: 
Mouse   229 KMMYLKNNLPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQECE- 292

  Fly   258 HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAK---IDKIVQKAFL 318
            :|:...|.|||||||:|....|......||:.|:|..| |||:|:   ||::   |.|||.|:::
Mouse   293 NLQNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGM---SGSRDLFISKIVHKSYV 354

  Fly   319 KIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            :::|:|.|..||      ...::......||||..||||.:.|..|..  :.|.|.:..|
Mouse   355 EVNEEGTETDAA------MPGTVVGCCLMPMEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 123/374 (33%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 124/383 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.