DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn53F

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:400 Identity:102/400 - (25%)
Similarity:175/400 - (43%) Gaps:51/400 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLYLLLLATS-----VESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEEL 60
            |..|.|:||..|     ..|...::.|..:.:..:.||:::|.......|..:|:.......|::
  Fly     1 MYVLLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQI 65

  Fly    61 RNVLKFSENKTLVANNYRSL-LSDLKRRETFI---------ILHMANRIYVNKKYCLVPEFNQLA 115
            |.           |.:||.. ||:.|.:...|         :.....|.||.:...:..|:....
  Fly    66 RK-----------AMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFM 119

  Fly   116 RKAFKAKAKSI-----RLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKG 175
            |.. :.:|::|     :||:       ||::..:.....|..:|....:..::...|||||:|..
  Fly   120 RHT-EGRARNIAFAREQLDE-------VNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNL 176

  Fly   176 QWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPN 240
            .|...|..:.|:..:|.|:|.:.:.:.||...:....|.:.::.|..:.:|:.:..|.|.:|.|:
  Fly   177 SWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPD 241

  Fly   241 SVDGLRKLKEKVGFIDY-----HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNG 300
            ..|||..|:.|:..::.     :|....|.|.:|||||.|..:|...||.:||.|:||||...:.
  Fly   242 QPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFST 306

  Fly   301 LV-LESGAKIDKIVQKAFLKIDEKG-GEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHD 363
            |: ..:..:||.::.....:..|:| |..|...|     ..|:.:.......|:|.|||.:.|.|
  Fly   307 LLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVG-----NGSLTHTFNGVKYFLATHPFAFYIID 366

  Fly   364 NKVIYFQGHI 373
            |..|||.||:
  Fly   367 NTSIYFAGHV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 94/377 (25%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 94/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.