DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:375 Identity:107/375 - (28%)
Similarity:193/375 - (51%) Gaps:33/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE----NKTLVANNYRSLLSDLKRRE 88
            :::.:|:::||:|....::||:|.:.|.|..::...|...:    ....|...::|||:.:.:..
  Rat    21 EDSSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSLDKCSGRGSRDVHQGFQSLLAKVNKTG 85

  Fly    89 TFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD-PVSASAIVNSWILNRTRGM--- 149
            |..:|..|||::..|.:.::..|....||.::|:.:.:.... |..:...:|:|:..:|.|.   
  Rat    86 TQYLLKTANRLFGEKTFDILASFKDACRKFYEAEMEELDFKGAPEQSRQHINTWVAKKTEGQSIS 150

  Fly   150 --------IRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTL 206
                    |..::.....|::|...|||||||||.|...|..:.|....|.|:.||..|||||..
  Rat   151 LNWNSQKKITELLSSGSVNANTPLVLVNAIYFKGNWKKQFNKEDTQEMPFKVTKNEEKPVKMMFK 215

  Fly   207 SASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSV 264
            .::....|:::|...|:.|||..:.|:|.|:||:....||.:::::   .||::    .:|::.|
  Rat   216 KSTFKMTYVEEISTTILLLPYVGNELNMIIMLPDEHIELRMVEKEITYKKFIEWTSLDKMEEREV 280

  Fly   265 NVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEAS 328
            .|.|||||:|....:|.:...||:.|.|:.. ||.:|:..:.|..:.|::.|:|::::|:|.||:
  Rat   281 EVFLPKFKLEENHDMKDVLHRLGMTDAFEQGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAA 345

  Fly   329 AATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            |||..      ::......|. |.|:|||.:.|..::.  |.|.|....|
  Rat   346 AATAA------NVTFRCMVPY-FCANHPFLFFIQHSRTNGIVFCGRFSSP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 106/370 (29%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 106/373 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.