DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpind1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:390 Identity:99/390 - (25%)
Similarity:181/390 - (46%) Gaps:48/390 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VESGFWEDFYRILASQ-NAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE-------- 68
            |.:.|....||.|.:: |...|::.:|:...|.|.|:.:..|..|.|:|...:.|:|        
Zfish   137 VNARFGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFAEFVNASNHY 201

  Fly    69 NKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDP-- 131
            :.:.|...:|.|...|.||.....|...|.:||.:...:...|...|:..:.|:.:|:...||  
Zfish   202 DNSTVHKLFRKLTHRLFRRNFGYTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSVDFADPAF 266

  Fly   132 -VSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSA 195
             |.|    |..|...|:|:|:..:  |..:.:.:..|:|.:||||.|...|..:.||...|.|:.
Zfish   267 LVKA----NQRIQKITKGLIKEPL--KSVDPNMAVMLLNYLYFKGTWEQKFPKELTHHRQFRVNE 325

  Fly   196 NEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVG--FID-- 256
            .:.:.|.||....|.|:....:::..|::||| ...:||.|.:|..:.|:|.|::::.  .::  
Zfish   326 KKQVRVLMMQNKGSYLAAADHELNCDILQLPY-AGNISMLIAVPQKLSGMRSLEQEISPTLVNKW 389

  Fly   257 -YHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAF--- 317
             .::..::..|..|:||:|....|....:.:|:.|:|....|.:.:..|      |::...|   
Zfish   390 LSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPMTSE------KVIINWFKHQ 448

  Fly   318 --LKIDEKGGEASAAT--GVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
              :.::|:|.||:|.|  |.:.         :.....||.|.||.::|::::.  :.|.|.:|:|
Zfish   449 GSITVNEEGTEAAAMTHIGFMP---------LSTQTRFIVDRPFLFLIYEHRTGCVVFMGRVVDP 504

  Fly   377  376
            Zfish   505  504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/381 (25%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 99/390 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.