DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn43Ad

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:363 Identity:93/363 - (25%)
Similarity:168/363 - (46%) Gaps:31/363 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF--SENKTLVANNYRSLLSDLKRRETF-IILH 94
            |::.||:..:..:|::|..|..:...:||..|:.  :.:..|...::.:||:|||:.... ..|.
  Fly    55 NVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLR 119

  Fly    95 MANRIYVNKKYC--LVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPK 157
            :.:.:|..:::.  ...||..||.: .......:..:...:|:..:|...|:|:...:..:|...
  Fly   120 LLSDLYAQQRFTFNFRNEFETLAAR-MGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAP 183

  Fly   158 DFNS----DTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDI 218
            ...|    :|....|:.:.|:..|.:.|...:|...:|:...|....|..|..........:..:
  Fly   184 QLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPAL 248

  Fly   219 DAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYH-----LEKKSVNVKLPKFKIESKAQ 278
            ||::||:|:..:.|.|.|:.||..|||.:|:.|:...|.|     ||::.|.:.|||.::...:.
  Fly   249 DAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSD 313

  Fly   279 LKGIFENLGILDVFKPSADLNGL---VLESGA-KIDKIVQKAFLKIDEKGGEA--SAATGVLTRR 337
            ||.:.|.||:..:|.....|:.:   :|.|.| .:..:||...|::.|.||.|  |.:.|.|.||
  Fly   314 LKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRR 378

  Fly   338 KKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVE 375
                      .:..:.:|||||.|.:.|.:...||||:
  Fly   379 ----------ALPLVINHPFFYAIGNGKTLLLSGHIVD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/359 (25%)
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 90/359 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.