DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn42Db

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster


Alignment Length:363 Identity:115/363 - (31%)
Similarity:188/363 - (51%) Gaps:22/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LASQNAKRNLIYSPISAEIIMSMVYM--ASGGKTFEELRNVLKFSE-NKTLVANNYRSLLSDLKR 86
            |...:|..|:||||:|..|..:|:.|  :.|..|.:|:...|:|.. ....||.::..:   ||.
  Fly    21 LCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFGVV---LKS 82

  Fly    87 RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIR 151
            .|...:|.|||.:||.|...:..:|..:..:.|::|...|......:|| |:|.|:.::|..:|:
  Fly    83 YEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAAS-IINKWVESQTNNLIK 146

  Fly   152 NIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYID 216
            :|:.|:....|:...|||.|:|||:|..:|...:|...||: .::....|:||.:..:.....:.
  Fly   147 DIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRMMHVCENFFFAVLP 210

  Fly   217 DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFID-------YHLEKKSVNVKLPKFKIE 274
            ..:|..:.:.|....|:|.|:||:....|..|::|:..|.       .:|||  |:||:|.|..|
  Fly   211 MFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEK--VDVKIPSFTAE 273

  Fly   275 SKAQLKGIFENLGILDVFKPSADLNGLV-LESGAKIDKIVQKAFLKIDEKGGEASAAT-GVLTRR 337
            .:.:|..:...:|:..:|...|:|.|:: .|....:.:||.|||::|:|.|.||:||| .|.|.|
  Fly   274 FQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFR 338

  Fly   338 KKSIDNLIQPPMEFIADHPFFYVIHDN-KVIYFQGHIV 374
              |:.....||..|.|:.||||.|.|| ..:.|.||.:
  Fly   339 --SMPARQGPPKVFHANRPFFYAIKDNTHGLLFAGHFI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 114/360 (32%)
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 114/360 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446377
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
99.000

Return to query results.
Submit another query.