DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn31A

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:382 Identity:104/382 - (27%)
Similarity:186/382 - (48%) Gaps:47/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVL----KFSENKTLVANNYRSLLS 82
            |..:|:..|::|::.||:..|..:|::::.|.|.|.|||:..|    :|:.|..: ||.|.:.|.
  Fly    19 YHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKM-ANFYAAELG 82

  Fly    83 DLKR-RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLD----------DPVSASA 136
            ::.. .:||  |.:.||:.::.:..:..:|.::|:..|.|.|:.:.|:          :.:.||.
  Fly    83 NITTDADTF--LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASV 145

  Fly   137 IVNSWILNRTRGMIRNIVLPKDF-----NSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSAN 196
            ...||               ||.     :|..:..|:.|...:.:|...|.|.:|.:.:|: |.:
  Fly   146 GGGSW---------------KDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGS 194

  Fly   197 EIIPVKMMTLSASLLS-GYIDDIDAKIIELPYWNS-TLSMRIILPNSVDGLRKLKEK-----VGF 254
            ::..|.|:......:. ..:.|:||:.|||||.:: .|||.:||||...||::|:::     :|.
  Fly   195 QVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGA 259

  Fly   255 IDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLK 319
            :...::.:.|.|.||||.|:.:..|:...:.||..::|..||:...|...:...|..::||..:.
  Fly   260 LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRIN 324

  Fly   320 IDEKG-GEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVE 375
            ::|.| |.........|..|..:.:.......|.||||||:.|....|.|..||:||
  Fly   325 LNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVVE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 101/378 (27%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.