DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn28Dc

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:435 Identity:109/435 - (25%)
Similarity:186/435 - (42%) Gaps:94/435 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQNAK-RNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSD 83
            :|..||....|. :..||||:|....::::.:.:.|:::|||..|....:...| ...:..:|.|
  Fly   114 NFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRL-HEQFGLMLQD 177

  Fly    84 LKR--RETFII--------------------------LHMANRIYVNKKYCLVPEFNQLARKAFK 120
            |::  ||....                          :|:||.::....|.|.|::.::..:.: 
  Fly   178 LQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVY- 241

  Fly   121 AKAKSIRLDD----PVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNF 181
              |..:::.|    |.:|...:|:::...|:..|.||: ..|....|...|.||:|||..|..:|
  Fly   242 --ASDLQIQDFEGSPATARYNINAYVAQHTKNHIENII-ASDIPQTTRMILANALYFKAFWETDF 303

  Fly   182 KADQTHIADFYVSANEIIPVKMMTLSASLLSG---YIDD--IDAKIIELPYWNSTLSMRIILP-- 239
            ....|...:||.:.....||..:.:.|:  .|   |.:|  :..|||.|||..:..:|.||.|  
  Fly   304 IESATRPDNFYPNGEGTEPVMRVQMMAT--GGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFK 366

  Fly   240 NSVDGLRKLK-----EKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLN 299
            :||..|..|:     :|:..:...:.:::..|..||..:.....||.:.:.:|:..:|  ||..|
  Fly   367 SSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIF--SAVQN 429

  Fly   300 GLVL---------------------------ESGAK----IDKIVQKAFLKIDEKGGEASAATGV 333
            .|.|                           ..||:    :|.||.|....::|:|.||:|::  
  Fly   430 DLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS-- 492

  Fly   334 LTRRKKSIDNLIQPPMEFIADHPFFYVI-HD-NKVIYFQGHIVEP 376
            :|..|||     .|.:.|..|.||..:: || .|::.|.|.|.||
  Fly   493 VTYLKKS-----GPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 106/430 (25%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 105/428 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.