DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina7

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:385 Identity:93/385 - (24%)
Similarity:177/385 - (45%) Gaps:36/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVA-- 74
            |:.:.|....||.|:.:|...|:.:||:|..:.::|:...||..|..::..||.|:...|.|.  
Mouse    55 SINADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFNLTDTPVTEL 119

  Fly    75 -NNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIV 138
             ..::.|:..|...:..:.|.|.|.:::.::...:.:|....:..::.:..|....:..:|...:
Mouse   120 QQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKI 184

  Fly   139 NSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQT-HIADFYVSANEIIPVK 202
            ||::..:|:|.|..::  :....:....|||.|:|:.||...|:..:| ..::|.|..:..:.|.
Mouse   185 NSYVEKQTKGKIVGLI--QGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVP 247

  Fly   203 MMTLSASLLSGYID-DIDAKIIELPYWNSTLSMRIILPN-----------SVDGLRKLKEKVGFI 255
            ||. .......|:| :::..::::.|..:.|:: .:||.           |...|:|.       
Mouse   248 MMH-QLEQYYHYVDMELNCTVLQMDYSENALAL-FVLPKEGHMEWVEAAMSSKTLKKW------- 303

  Fly   256 DYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKI 320
            :|.|:|..|.:.:|||.|.:...|....:.:|:.|.|..|||..|:..:||.|:.....||.|.|
Mouse   304 NYLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITEDSGLKLSYAFHKAVLHI 368

  Fly   321 DEKGGEASAATGVLTRRKKSIDNLIQPPMEFI--ADHPFFYVIHDNKV--IYFQGHIVEP 376
            .|:|.:..|:..|     .|:|....||:..:  .|..|..:|.:.:.  :.|.|.:|.|
Mouse   369 GEEGTKEGASPEV-----GSLDQQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLVNP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/375 (24%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 89/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.