DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA9

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:388 Identity:90/388 - (23%)
Similarity:171/388 - (44%) Gaps:42/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKT---LV 73
            |:.:.|....||.|..:...:|:.:||:|....::|:.:.:...|..::...|.|:...|   .:
Human    46 SLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAI 110

  Fly    74 ANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIV 138
            ...::.|:..|......:.|.|.:.::|.|:..|...|....::.::|:..|....:|..|.|.:
Human   111 HQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARI 175

  Fly   139 NSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTH-IADFYVSANEIIPVK 202
            ||.:..:|:|.:.:|:...|..  |:..|||.|:||.:|...|..:.|. ...|.|.....:.|.
Human   176 NSHVKKKTQGKVVDIIQGLDLL--TAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVP 238

  Fly   203 MMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF-----IDYHLEKK 262
            ||........|...:::..::::.|....::. .:|| |...:|:|::.:..     ..:.|:|:
Human   239 MMHQKEQFAFGVDTELNCFVLQMDYKGDAVAF-FVLP-SKGKMRQLEQALSARTLRKWSHSLQKR 301

  Fly   263 SVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEA 327
            .:.|.:|:|.|.:...|:.|...:||.:||..:||.:|:......::.|...||.|.:.|:|.||
Human   302 WIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEA 366

  Fly   328 SAATGV--LTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV------------IYFQGHIVEP 376
            :|||..  :.|.|               |.|.::.:..|:.            |.|.|.:..|
Human   367 TAATTTKFIVRSK---------------DGPSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 88/378 (23%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.