DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Spn28Db

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster


Alignment Length:385 Identity:128/385 - (33%)
Similarity:204/385 - (52%) Gaps:33/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLYLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLK 65
            :|||.|||:||||...|..:... |....|:.|.|.||:..||.:||:.|.:.|.|.||||:||.
  Fly     7 IKYLVLLLIATSVLGKFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD 70

  Fly    66 FSENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD 130
            ...:.|.:|..|..::|:.::...   |...|.:|||:.|.:..::|.|.:..|.|:.|     |
  Fly    71 LPVDVTEMAKKYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGK-----D 127

  Fly   131 PVS---ASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFY 192
            |:|   ||..::..|..::...:|.|....:...:.||.|||.:|:.|.|...|....|.:..|:
  Fly   128 PLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFH 192

  Fly   193 VSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILP------NSVDG-LRKLKE 250
            ...|:.:.|:||:.....  ...|....:|||:|:.||.|||.|.||      :|::. ||.|.|
  Fly   193 GDHNKKVYVRMMSHVGRF--RIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSE 255

  Fly   251 KVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLE-SGAKIDKIVQ 314
            .       |.:.:|:|:||||||:.:.:|....:.|||..:|..::||:||:.. :||||:.:|.
  Fly   256 S-------LVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVH 313

  Fly   315 KAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIV 374
            |:|::|:|:|    |:||..:...:||....:....|..:.||.::|.|...:||:|.:|
  Fly   314 KSFIEINERG----ASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRVV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 117/366 (32%)
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 117/367 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468704
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.