DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpina1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:387 Identity:108/387 - (27%)
Similarity:193/387 - (49%) Gaps:37/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVESGFWEDFYRILAS--QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE- 68
            ||...:.:..|  ..|:.|||  ....:|:.:||:...:.:|::.:.:...|..::.:.|.:|. 
Zfish    65 LLAPHNADFAF--SLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSAL 127

  Fly    69 NKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVS 133
            ....|...|..||..|...:..:.|.....:.:...:.:|.:|.:.|:..:.::|..:....|..
Zfish   128 TPEQVNEGYEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEI 192

  Fly   134 ASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEI 198
            |:|.:|.:|..:|...|.|:|  ||.::||...|:|.:||:|:|...|.|..||.|||.|..:..
Zfish   193 AAAEINKFIARKTHDKITNMV--KDLDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQDTT 255

  Fly   199 IPVKMMTLSASLLSGYIDDID-AKIIELPYWNSTLSMRIILPNSVDG-LRKLKEKVGFIDYHLE- 260
            :.|.||..:.. ...|.|.:: ..::.:||..:| ||.|:||:  || :::|:|.:  ..:||: 
Zfish   256 VQVDMMKRTGR-YDIYQDPVNQTTVMMVPYKGNT-SMMIVLPD--DGKMKELEESI--CRHHLKN 314

  Fly   261 ------KKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLK 319
                  :.||::.:|||.|.:.::|.||.:::|:.|.|...||.:|:..|...|:.:::.:|.:.
Zfish   315 WHDKLFRSSVDLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGMTEEVKVKVSQVLHQAVMS 379

  Fly   320 IDEKGGEASAATGVLTRRKKSIDNLIQP---PMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            :||||.||:|.|.:          .|.|   |...|.:.||..:|.::..  |.|.|.|..|
Zfish   380 VDEKGTEAAAITTI----------EIMPMSLPDTVILNRPFLVLIVEDSTMSILFMGKITNP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/372 (28%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 104/378 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.