DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpine3

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:386 Identity:77/386 - (19%)
Similarity:157/386 - (40%) Gaps:58/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VESGFW---EDF----YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK 70
            :..|.|   .:|    ||..|::....|.:.||.|..:.:.::...:.|.|..:|...|.::...
Mouse    24 LSEGLWLLKTEFALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQD 88

  Fly    71 TLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS 135
            ..|.....::.:........:.:.:|..:::.....|.|.|.:...:...:..::....:|.|.:
Mouse    89 PRVKEFLHAVYTTRHNSSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAADFSEPNSTT 153

  Fly   136 AIVNSWILNRTRGMIRNIVLPKDFNSD---TSAFLVNAIYFKGQWLYNFKA-----DQTHIADFY 192
            ...:.....::.|  .....|....:|   |...:::.:.|:..|...|..     ..||     
Mouse   154 TEASKVTSRQSTG--EGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFSVVLQPLPFTH----- 211

  Fly   193 VSANEIIPVKMMTLSASLLSGYIDDI---DAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF 254
             :...::.|..|...|.:..|...|.   :..::||.|.....|:.::||         ::|...
Mouse   212 -AHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLP---------QDKGTP 266

  Fly   255 IDY---------------HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVL 303
            :|:               .|::..::|.||:|||:::..:|.|..:.||.|:|.| .|:|.|:..
Mouse   267 LDHIEPHLTARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGISG 331

  Fly   304 ESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN 364
            :.|..:.::..||.:::.|:|..:||||.||..|:....       .|.||.||.:::.::
Mouse   332 QDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSRTS-------AFKADRPFIFLLREH 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 76/382 (20%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 77/386 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.