DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and RGD1562844

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:272 Identity:77/272 - (28%)
Similarity:134/272 - (49%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-A 136
            :...::.|...|.:.|.:..|.|||.|:|:|...::|.|.:...:.:.::.:.:...:....| .
  Rat    16 IHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAEAAEESRK 80

  Fly   137 IVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPV 201
            .||:|:..:|.|.|..::.....:..|...||||:|.|..|...|....|....|.::.||..||
  Rat    81 HVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPV 145

  Fly   202 KMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKS--- 263
            :||.........|:.::.|.::.:||....|...::||:....:.|::|::.|     ||.:   
  Rat   146 QMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTF-----EKLTAWT 205

  Fly   264 ---------VNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFL 318
                     |.|.|||||:|....||.:.:.|||:|.|:.: |||:.:..|....:.|.|.|:.:
  Rat   206 QPDTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAMAPERNLCVSKFVHKSVV 270

  Fly   319 KIDEKGGEASAA 330
            :::|||.||:||
  Rat   271 EVNEKGTEAAAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 77/272 (28%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.