DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb9d

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:347 Identity:89/347 - (25%)
Similarity:169/347 - (48%) Gaps:27/347 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MVYMASGGKTFEELRNVLKFSENKTL-VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPE 110
            ||.:.:.|.|..::...|..:::... :..:::.||.:|.:.::...|.:|||::......|||.
  Rat     1 MVLLGAKGDTAVQISQALNLNKHPDEDIHKDFQLLLHNLNKPKSHYCLRIANRLFAENTCKLVPT 65

  Fly   111 FNQLARKAFKAKAKSIRLDDPVSAS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFK 174
            :.:...:.:.::.:.:........| ..:|:|:..:|.|.|..::......|:|...:|||:||:
  Rat    66 YKESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALYFQ 130

  Fly   175 GQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILP 239
            |.||:.|..:.|....|.::..|..||:||....:....|:.:|.|:|:.:||....:|..::||
  Rat   131 GSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGMEMSFMVLLP 195

  Fly   240 NSVDGLRKLKEKVGFIDYHLEK------------KSVNVKLPKFKIESKAQLKGIFENLGILDVF 292
            :....:||::..:.|     ||            ..|.|.||||:::.:..:..:|::||::|||
  Rat   196 DEGVDIRKVESSLTF-----EKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALFQHLGMIDVF 255

  Fly   293 KP-SADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHP 356
            .. .|||:|:..|....:.|.|.:..::::|:|.||:||:..     ....:..:....|.||.|
  Rat   256 SEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAA-----DCCYSCSEYTPTFCADRP 315

  Fly   357 FFYVIHDNKV--IYFQGHIVEP 376
            |.:.|..|:.  |.|.|....|
  Rat   316 FLFFIRHNQTNSILFCGRFSSP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 88/342 (26%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 88/345 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.