DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and RGD1564786

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:370 Identity:107/370 - (28%)
Similarity:192/370 - (51%) Gaps:22/370 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL----VANNYRSLLS 82
            :::| .::..:|:.:|..|....:||:.|.:.|.|..::...:...:..::    |..::.|||:
  Rat    58 FKVL-GEDISKNVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCNSIGGGDVHQHFLSLLT 121

  Fly    83 DLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD-PVSASAIVNSWILNRT 146
            .:.:.:|..:|..||.:::...:.::..|.....|.::|:.:.:.... |..:...:|:|:..:|
  Rat   122 KVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQHINTWVAKKT 186

  Fly   147 RGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLL 211
            ..:||.::.|...||:|..||||.|||||.....|....|....|.||.||...|:||:..::..
  Rat   187 EDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTVQMMSQKSTFK 251

  Fly   212 SGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVKLP 269
            ..|:.||..:::.||:.||.|||...:|:|....|||:.::   .|:::    .:|:|.:.|.||
  Rat   252 MTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDKFLEWTDEDTMEEKEMEVFLP 316

  Fly   270 KFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGV 333
            :.|:|....:.|:...||:.|.| :..||.:|:..:.|..:.|:|.|:|:::.|:|.||:|.|.|
  Rat   317 RIKLEESYDMNGVLRKLGMTDAFEEDKADFSGISSKHGLFLSKVVHKSFVEMSEEGTEAAAPTDV 381

  Fly   334 LTRRKKSIDNLIQPPMEFIADHPFFYVIHD--NKVIYFQGHIVEP 376
            :|.:..      ..|...||||||.:.|.|  :|.|.|.|....|
  Rat   382 VTMKSP------LTPRCLIADHPFLFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 106/365 (29%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 106/368 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.