DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinh1b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:382 Identity:97/382 - (25%)
Similarity:172/382 - (45%) Gaps:32/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK-TLVA 74
            ||....|  :.|..:|.:....|::.||:.....:.||.|.|...|..::::|||....| ..:.
Zfish    33 TSANLAF--NLYHNVAKEKGLENILISPVVVASSLGMVAMGSKSSTASQVKSVLKADALKDEHLH 95

  Fly    75 NNYRSLLSDLKRRET-FIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIV 138
            .....||:::...:| .:...::||:|.........:|.:.::|.:..:...|...|..||...:
Zfish    96 TGLSELLTEVSDPQTRNVTWKISNRLYGPSSVSFAEDFVKNSKKHYNYEHSKINFRDKRSAINSI 160

  Fly   139 NSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKM 203
            |.|....|.|.:..|.  ||..:...|.:|||::||..|...|.........|.|:.:..:.|.|
Zfish   161 NEWAAKTTDGKLPEIT--KDVKNTDGAMIVNAMFFKPHWDEKFHHKMVDNRGFLVTRSHTVSVPM 223

  Fly   204 MTLSASLLSGYIDDIDAK--IIELPYWNSTLSMRIILPNSVDGLRKL-----KEKVGFIDYHLEK 261
            |..:.  :.|:.:|.:.:  |:.:|..:...||..|:|..|:.|.:|     ::::......||:
Zfish   224 MHRTG--IYGFYEDTENRFLIVSMPLAHKKSSMIFIMPYHVEPLDRLENLLTRQQLDTWISKLEE 286

  Fly   262 KSVNVKLPKFKIESKAQLKGIFENLGILD-VFKPSADLNGLVLESGAK---IDKIVQKAFLKIDE 322
            ::|.:.|||..:|....|:.....||:.: |.|..|||:.:   ||.|   :..:...:.|:.|.
Zfish   287 RAVAISLPKVSMEVSHDLQKHLGELGLTEAVDKSKADLSNI---SGKKDLYLSNVFHASSLEWDT 348

  Fly   323 KGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEPR 377
            :|.....:  :....|      ::.|..|.|||||.:::.|||.  |.|.|.:|.|:
Zfish   349 EGNPFDPS--IFGSEK------MRNPKLFYADHPFIFLVKDNKTNSILFIGRLVRPK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 93/370 (25%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 95/376 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.