DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and LOC299282

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:395 Identity:108/395 - (27%)
Similarity:192/395 - (48%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYLYLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF 66
            :.|:.|.||:| .:.|....|:.||.:|..:|:::||:|....::::.:.:...|.||:...|||
  Rat    38 RQLHSLTLASS-NTDFALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKF 101

  Fly    67 SENKTL---VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL 128
            :..:..   :...:..||..|.:.|..:.::..:.::::|:..::.||.:..|..::|:|.....
  Rat   102 NLTEITEEEIHQGFGHLLQRLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADF 166

  Fly   129 DDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYV 193
            ..|..|..::|.::.|:|:|.|..:.  .|....||..|||.:.|||:|...|..:.|..::||:
  Rat   167 KQPNEAKKLINDYVSNQTQGKIAELF--SDLEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYL 229

  Fly   194 SANEIIPVKMMTLSASLLSGYI--DDIDAKIIELPYWNSTLSMRIILPN-----------SVDGL 245
            .....:.|.||.:. .:.:.|:  :::...::||.| ....|...|||:           ..:.|
  Rat   230 DEKRSVKVPMMKIK-EVTTPYVRDEELSCSVLELKY-TGNASALFILPDQGKMQQVESSLQPETL 292

  Fly   246 RKLKEKVGFIDYHLEKKSVN-VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKI 309
            :|.|:.       |..:.:| :::|||.|.:...||.:...|||..||...|||:.:.......:
  Rat   293 KKWKDS-------LIPRIINDLRMPKFSISTDYSLKEVLPELGIKKVFSQQADLSRITGTKDLYV 350

  Fly   310 DKIVQKAFLKIDEKGGEASAATGVLT--RRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGH 372
            .::|.||.|.:||.|.||:|||||.|  ||:....|..:|.|..|.|       .|::.|.|...
  Rat   351 SQVVHKAVLDVDETGTEATAATGVATVIRRQPRTLNFNRPFMVVITD-------MDSQSILFVAK 408

  Fly   373 IVEPR 377
            |..|:
  Rat   409 ITNPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 101/374 (27%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 107/393 (27%)
RCL 365..389 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.