DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serping1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:384 Identity:89/384 - (23%)
Similarity:168/384 - (43%) Gaps:66/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE-----NKTLVANNYRSL 80
            ::...|::.|:.|:.:||.|...:::.|.:.:|..|...|.::|.:.:     ::||.|.:.:.:
  Rat   159 YHAFSATKKAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSYPKDFACVHQTLKAFSSKGV 223

  Fly    81 LS--------DLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAI 137
            .|        ||..|:|::...::  :|.:....|.|:.:        |..|            :
  Rat   224 TSVSQIFHSPDLAIRDTYVNASLS--LYGSSPRVLGPDGD--------ANLK------------L 266

  Fly   138 VNSWILNRTRGMIRNIV--LPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIP 200
            :|:|:...|...|..::  ||    |||...|:||:|...:|...|  :|..:...::..|.:|.
  Rat   267 INTWVAENTNHKINELLDSLP----SDTRLVLLNAVYLSAKWKKTF--EQKKMMASFLYKNSMIK 325

  Fly   201 VKMMTLSASLLSGYIDD-IDAKIIELPYWNSTLSMRIILPNS----VDGLRKLKEKVGF--IDYH 258
            |.|::.....|:.:.|. :.||:.:|.. :..||..|::|.|    ::.:.|......|  |...
  Rat   326 VPMLSSKKYPLALFNDQTLKAKVGQLQL-SHNLSFVIMVPQSPTHQLEDMEKALNPTVFKAILKK 389

  Fly   259 LEKKSVN---VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKI 320
            ||.....   |.:|:.|::|...:..|.|.|...| |....:|.||..:...::..:..:..|::
  Rat   390 LELSKFQPTYVMMPRIKVKSSQDMLSIMEKLEFFD-FTYDLNLCGLTEDPDLQVSSMKHETVLEL 453

  Fly   321 DEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHD--NKVIYFQGHIVEPR 377
            .|.|.||:||:.:...|...|         |....||.:::.|  :|...|.|.:.:||
  Rat   454 TETGVEAAAASTISVARNLLI---------FEVQQPFLFLLWDQRHKFPVFMGRVYDPR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 87/378 (23%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 87/378 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.