DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:376 Identity:103/376 - (27%)
Similarity:197/376 - (52%) Gaps:36/376 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANN---------YR 78
            |:|...::| |:.:||:|....:||:.:.:.|.|..::..||....     .|.         ::
  Rat    17 RVLGEDSSK-NVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYN-----CNGNGGGDFHQCFQ 75

  Fly    79 SLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD-PVSASAIVNSWI 142
            |||:::.:.:...:|..:|.::|...:.::..|....||.::|:.:::.... |..:...:|:|:
  Rat    76 SLLTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHINTWV 140

  Fly   143 LNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLS 207
            ..:|..:||.::.|...||:|...|:|:.||||.|...|..:.|....|.||.||...|:||...
  Rat   141 AKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQMMFNK 205

  Fly   208 ASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF---IDY----HLEKKSVN 265
            ::..:.:::||...:..|||..:.||:.|:||:....||.::.::.:   |::    :::::.|.
  Rat   206 SNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQEEEVE 270

  Fly   266 VKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASA 329
            :.||:||:|....:|.:...||:.:.|:.. ||.:|:..:.|..:.|:|.|:.::::|:|.||:|
  Rat   271 ILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKPGLFLSKVVHKSVVEVNEEGTEAAA 335

  Fly   330 ATGVLTRRKKSIDNLIQP--PMEFIADHPFFYVIHD--NKVIYFQGHIVEP 376
            .|.::|        :..|  |...:|||||.::|.|  ||.|.|.|....|
  Rat   336 PTEIVT--------MGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 102/371 (27%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.