DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6a

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:366 Identity:117/366 - (31%)
Similarity:197/366 - (53%) Gaps:22/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVL---KFSEN-KTLVANNYRSLLSDLKRR 87
            |:::..|:..||||....::||:|.:.|.|..::...|   |.|.| ...|...::|||:::.:.
  Rat    41 SEDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVHQGFQSLLAEVNKT 105

  Fly    88 ETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL-DDPVSASAIVNSWILNRTRGMIR 151
            .|..:|..|||::..|...::..|....||.::|:.:.:.. .|...:...:|:|:..:|...|:
  Rat   106 GTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDFKGDTEQSRQRINTWVAKKTEDKIK 170

  Fly   152 NIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYID 216
            .::.|...:.||...|||||||||.|...|..:.|....|.||..|..||:||.:.::....||.
  Rat   171 ELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTREKPFKVSKTEEKPVQMMFMKSTFKMTYIG 235

  Fly   217 DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVKLPKFKIE 274
            :|..||:.|||..:.|:|.|:||:....|:.:::::   .||::    .|:::.|.|.||:||:|
  Rat   236 EIFTKILLLPYAGNELNMIIMLPDEHIELKTVEKELTYEKFIEWTRLDMLDEEEVEVFLPRFKLE 300

  Fly   275 SKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATG-VLTRR 337
            ....:|.:...||:.|.| :..||.:|:..:.|..:.|::.|||::::|:|.||.|||| .:|.|
  Rat   301 ENYDMKVVLGKLGMTDAFMEGRADFSGIASKQGLFLSKVIHKAFVEVNEEGTEAVAATGSTITMR 365

  Fly   338 KKSIDNLIQPPMEFIADHPF-FYVIH-DNKVIYFQGHIVEP 376
                  .::....|:||||| |::.| ..|.|.|.|....|
  Rat   366 ------CLRFTPRFLADHPFLFFIQHVKTKGILFCGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 116/361 (32%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 116/364 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.