DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinf2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:376 Identity:90/376 - (23%)
Similarity:162/376 - (43%) Gaps:44/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLL 81
            |..|.:.::|..:...||:.||:|..:.:|.:.:.:..:|.|.|:.||..:....:     ..||
  Rat    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCI-----PHLL 148

  Fly    82 SDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASA-------IVN 139
            |...:......:.:|.|||:.|.:.:..:|.:.:.|.|.||        ||..:.       .:|
  Rat   149 SHFCQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAK--------PVKLTGRQEEDLMNIN 205

  Fly   140 SWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMM 204
            .|:...|.|.|.:.:  .:...:|...|:|||:|.|.|...|....|....|::.....:||.||
  Rat   206 KWVKEATEGKIEDFL--SELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMM 268

  Fly   205 TLSASLLSGY-IDDIDAKIIELPYWNSTLSMRIILP-----NSVDGLRKLKEKVGFIDYHLEKKS 263
            ...:..|..: ::..:.::...|:.|: :|..:|:|     |..:.|..|.... .....:.:|.
  Rat   269 HAQSYPLRWFLLEQPEIQVAHFPFQNN-MSFVVIMPTYFGWNVSEVLANLTWDT-LYQPSMREKP 331

  Fly   264 VNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEAS 328
            ..|:|||..:|....|......||:.|:|: |.||.| :.:....:..:..::.:::.|.|.||:
  Rat   332 TKVRLPKLHLEQHLDLVATLSKLGLQDLFQ-SPDLRG-ISDQSLVVSSVQHQSTMELSEAGVEAA 394

  Fly   329 AATG-VLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            |||. .:||...|         .|..:.||.:.|.:..  :..|.|.:..|
  Rat   395 AATSTAMTRMSLS---------SFFLNRPFIFFIMEETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 89/371 (24%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 89/371 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.