DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinf1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:383 Identity:88/383 - (22%)
Similarity:173/383 - (45%) Gaps:36/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS-ENKTL 72
            ||.:| |.|..|.||:.:...:..|::.||:|....:|.:.:.:..:|...:...|.:. .|...
  Rat    54 LAAAV-SNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPD 117

  Fly    73 VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAI 137
            :.:.|:.||:.:...|.  ....|:||...:|..:...|.....|::..:.: |...:|......
  Rat   118 IHSTYKELLASVTAPEK--NFKSASRIVFERKLRVKSSFVAPLEKSYGTRPR-ILTGNPRIDLQE 179

  Fly   138 VNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVK 202
            :|:|:..:.:|.|....  ::..|..|..|:...||||||...|.:.:|.:.||::..:..:.|.
  Rat   180 INNWVQAQMKGKIARST--REMPSALSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTVRVP 242

  Fly   203 MMTLSASLLS-GYIDDIDAKIIELPYWNSTLSMRIILPNSV-DGLRKLKEK-----VGFIDYHLE 260
            ||:...::|. |...|::.||.:||...| :|:...||.:| ..|..::|.     |..||..|:
  Rat   243 MMSDPKAILRYGLDSDLNCKIAQLPLTGS-MSIIFFLPLTVTQNLTMIEESLTSEFVHDIDRELK 306

  Fly   261 KKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGG 325
            .....:.:||.|:..:..:....:::.:..:|: |.|.: .:.....|:.::..:|..:.:|:|.
  Rat   307 TIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLFE-SPDFS-KITGKPVKLTQVEHRAAFEWNEEGA 369

  Fly   326 EASAATGVLTRRKKSIDNLIQP-----PMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            ..|:...            :||     |:::..:.||.:|:.|..  .:.|.|.|::|
  Rat   370 GTSSNPD------------LQPVRLTFPLDYHLNRPFIFVLRDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 82/370 (22%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 87/381 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.