DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina3b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:398 Identity:105/398 - (26%)
Similarity:191/398 - (47%) Gaps:43/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYLYLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF 66
            |.|..|.|| |:.:.|...||:.||.:|..:|:.:||......::.:.:.:.|.|.||:..||||
Mouse    40 KQLDSLTLA-SINTDFAFSFYKELALKNPHKNIAFSPFGIATALNSLTLGAKGNTLEEILEVLKF 103

  Fly    67 SENKTLVAN---NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL 128
            :..:|..|:   .::.||..|......:.:...|.::|.|...::.||.:.||..:..:..:...
Mouse   104 NLTETSEADIHQGFKHLLQRLSHPGDQVQIRTGNALFVEKHLQILAEFKEKARALYHTEVFTANF 168

  Fly   129 DDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYV 193
            ..|..|..::||::.|:|:|.|:.:|  .|.:.:||..:||.::||.:|:..|.:|.|.:..|.|
Mouse   169 QQPHEAMKLINSYMSNQTQGKIKELV--SDMDGNTSMVIVNDLFFKAEWMVPFNSDDTFMGKFIV 231

  Fly   194 SANEIIPVKMMTLSASLLSGYIDDIDAK--IIELPYWNSTLSMRIILPN-----SVDG------L 245
            ..:..:.|.||. :.:|.:.|..|.:.|  ::||.|..:..:| .|||:     .|:.      |
Mouse   232 DRSRHVKVPMMK-TKNLRTPYFRDEELKCTVVELNYKGNGKAM-FILPDQGKMQQVEASLQPGTL 294

  Fly   246 RKLKEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKID 310
            :|.::.:      ..:|...:.||||.:.....|:.|...|||.::|...|||:|:.......:.
Mouse   295 KKWRKSL------RPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSGITGVKNITVS 353

  Fly   311 KIVQKAFLKIDEKGGEASAATGV----LTRRKKSIDNLIQPPMEFIA-DHPFFYVIHD--NKVIY 368
            :::....|.:.|||.|..|.|.|    ::.:.|.:         |:. :..|.|::.|  :..|:
Mouse   354 EMIHSTELDMTEKGTEGDAITIVGYNFMSAKLKPV---------FVKFEDQFLYIVLDQGDLWIH 409

  Fly   369 FQGHIVEP 376
            ..|.::.|
Mouse   410 VMGKVINP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/378 (26%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 98/381 (26%)
RCL 367..392 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.