DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina5

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:377 Identity:98/377 - (25%)
Similarity:186/377 - (49%) Gaps:34/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EDF----YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS-----ENKTLVA 74
            :||    ||.|.|::..:|:.:||:|..:.:.|:.:.:|.||..::.:.|..|     |:|  :.
Mouse    44 KDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDK--LH 106

  Fly    75 NNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVN 139
            ..::.||...::....:.|.:.:.::.:....:..:|....:..:.:...|....:|..|...:|
Mouse   107 KGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQIN 171

  Fly   140 SWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMM 204
            :::..:|:|.|.:.:  ||.:|.....:||.|:||.:|...|....||..||:|:......|.||
Mouse   172 NYVAKQTKGKIVDFI--KDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMM 234

  Fly   205 TLSASLLSGYID-DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYH--------LE 260
            ..... .|.|:| :|...::.:||..:.::: .|||:  :|  |:|:....:|..        ..
Mouse   235 NREDG-YSYYLDQNISCTVVGIPYQGNAIAL-FILPS--EG--KMKQVEDGLDERTLRNWLKMFT 293

  Fly   261 KKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGG 325
            |:.:::.||||.||:..:|:.:...|||.|||...|||:|:...:..|:.::|.|:.::::|.|.
Mouse   294 KRRLDLYLPKFSIEATYKLENVLPKLGIQDVFTTHADLSGITDHTNIKLSEMVHKSMMEVEESGT 358

  Fly   326 EASAATG-VLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVEP 376
            .|:|.|| :.|.|.....:|   .:||  ..||...:.::..|.|.|.:..|
Mouse   359 TAAAITGAIFTFRSARPSSL---KIEF--TRPFLLTLMEDSHILFVGKVTRP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 97/372 (26%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 97/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.