DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA11

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:376 Identity:95/376 - (25%)
Similarity:179/376 - (47%) Gaps:39/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVAN---NYRSLLSD 83
            |:.||: :|..|:.:||:|....::::.:.:...|...:...|.|:..:|..|:   .:||||..
Human    62 YKELAA-DAPGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADIHQGFRSLLHT 125

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQL--ARKAFKAKAKSIRLDDPVSASAIVNSWILNRT 146
            |......:.|.:.|.::::|:  |.|..:.|  .::.:.|.|.|....|.|:....:|.::..:|
Human   126 LALPSPKLELKVGNSLFLDKR--LKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQINDYLRRQT 188

  Fly   147 RGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIAD-FYVSANEIIPVKMMTLSASL 210
            .|.:.: .|| :|:.||...|.|.|:||.:|.:.|...||...: |:|.....:.|.||......
Human   189 YGQVVD-CLP-EFSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMH 251

  Fly   211 LSGYIDDIDAKIIELPYWNSTLSMRIILPN-----SVDG------LRKLKEKV--GFIDYHLEKK 262
            ...|..|:...::::.|..:.|:: ::||:     .|:.      |||..:.:  ..:|.|    
Human   252 RFLYDQDLACTVLQIEYRGNALAL-LVLPDPGKMKQVEAALQPQTLRKWGQLLLPSLLDLH---- 311

  Fly   263 SVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEA 327
                 ||:|.|.....|:.|...:|:.::....||.:|:..:....|.|:..||.:.:.|||.||
Human   312 -----LPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQLNKTISKVSHKAMVDMSEKGTEA 371

  Fly   328 SAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHD--NKVIYFQGHIVEP 376
            .||:|:|: :..|::.:..|...|  :.||..::.:  .:.:.|.|.:|.|
Human   372 GAASGLLS-QPPSLNTMSDPHAHF--NRPFLLLLWEVTTQSLLFLGKVVNP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 93/371 (25%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 93/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.