DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina4

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:378 Identity:92/378 - (24%)
Similarity:183/378 - (48%) Gaps:39/378 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL---VANNYRSLLSD 83
            |.::||||:::|:.:||:|..:.::::...:||.|..::...|.|:..|..   :...:|||...
  Rat    60 YHLIASQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKLSLPEIHEGFRSLQHT 124

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRG 148
            :.|..|...:.:.:.:.:::...::.||......::.:|.......|..:|..::|:::...|:|
  Rat   125 IARPFTEPQISVGSALILSQNLQILSEFVSAIETSYNSKVLHANFRDKEAAVQLINNYVKQNTQG 189

  Fly   149 MIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSG 213
            .|:|:|  .|.:.|....|||.|:|:|.|...|.:.:...:||||..|.::.:.|| |.......
  Rat   190 KIKNLV--SDLSPDVKMVLVNYIFFQGLWKKPFPSSRVSTSDFYVDENTVVKIPMM-LQDKEDHW 251

  Fly   214 YIDD--IDAKIIELPYWNSTLSMRIILP-----NSVDGL----------RKLKEKVGFIDYHLEK 261
            |::|  :...::.:.|....::. .|||     |.|:.:          |.|:.:..:       
  Rat   252 YLEDRRVPCTVLRMDYRGDAVAF-FILPDQGKMNEVEQVLSPGMLLRWKRLLQNRFFY------- 308

  Fly   262 KSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGE 326
            :.:.::||||.|.:..:|..|..:||..|:|.|:|:.:.:..:....:.|:..|..|.::|.|.:
  Rat   309 RKLILQLPKFSISNSYELDEILPDLGFQDLFTPNANFSNISKKEKLYLSKVFHKTVLDVNEVGTK 373

  Fly   327 ASAATGVLTRRKKSIDNLIQPPMEF-IADHPFFYVIH--DNKVIYFQGHIVEP 376
            |:||||.......:     ||...: |.:.||..:::  .::.|.|.|.:|.|
  Rat   374 AAAATGSFATFFSA-----QPKKRYLIFNRPFLVILYSTSSQDILFMGKVVNP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/373 (24%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 90/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.