DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpine1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:378 Identity:104/378 - (27%)
Similarity:175/378 - (46%) Gaps:27/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRS 79
            :.|....::.:...:..||:::||.....:::|:.:.:.|||.:::::.:.|:.::...|...|.
  Rat    36 TNFGVKVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALRK 100

  Fly    80 LLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILN 144
            |..:|........:..|:.|:|.:...||..|.....|.|:...|.:...:...|..|:|.|:..
  Rat   101 LSKELMGSWNKNEISTADAIFVQRDLELVQGFMPHFFKLFRTTVKQVDFSEMERARFIINDWVER 165

  Fly   145 RTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSAS 209
            .|:|||.:::.....|..|...||||:||.|||...|....||...|:.|....|.|.||..:..
  Rat   166 HTKGMISDLLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNK 230

  Fly   210 LLSGYI-----DDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHL--EKKSVNVK 267
            .  .|.     |..:..|:||||...||||.|..|...|  ..|......:|..|  :.||...:
  Rat   231 F--NYTEFTTPDGHEYDILELPYHGETLSMFIAAPFEKD--VPLSAITNILDAELIRQWKSNMTR 291

  Fly   268 ------LPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGG 325
                  ||||.:|::..|:|..|.||:.|:|..: ||...|..:....:.:.:||..::::|.|.
  Rat   292 LPRLLILPKFSLETEVDLRGPLEKLGMTDIFSSTQADFTSLSDQEQLSVAQALQKVKIEVNESGT 356

  Fly   326 EASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            .||::|.:|...:.:       |.|.:.|..|.:|:..|  :.|.|.|.::||
  Rat   357 VASSSTAILVSARMA-------PTEMVLDRSFLFVVRHNPTETILFMGQLMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 102/371 (27%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 102/376 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.